Anti GRB7 pAb (ATL-HPA057084)

Atlas Antibodies

Catalog No.:
ATL-HPA057084-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: growth factor receptor-bound protein 7
Gene Name: GRB7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019312: 57%, ENSRNOG00000006990: 59%
Entrez Gene ID: 2886
Uniprot ID: Q14451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGHTTGSVKPLSRSDAMELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKL
Gene Sequence QGHTTGSVKPLSRSDAMELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKL
Gene ID - Mouse ENSMUSG00000019312
Gene ID - Rat ENSRNOG00000006990
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRB7 pAb (ATL-HPA057084)
Datasheet Anti GRB7 pAb (ATL-HPA057084) Datasheet (External Link)
Vendor Page Anti GRB7 pAb (ATL-HPA057084) at Atlas Antibodies

Documents & Links for Anti GRB7 pAb (ATL-HPA057084)
Datasheet Anti GRB7 pAb (ATL-HPA057084) Datasheet (External Link)
Vendor Page Anti GRB7 pAb (ATL-HPA057084)