Anti GRAMD1B pAb (ATL-HPA075204)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075204-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GRAMD1B
Alternative Gene Name: KIAA1201, LINC01059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040111: 92%, ENSRNOG00000053577: 92%
Entrez Gene ID: 57476
Uniprot ID: Q3KR37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RFKMRRMKNVQEQSLEAGLARDLPAVLAPGKEFLQLPSIEITPSSDEDTPWSNCSTPSASPRRKRFLLRKWLRVRERKECSESSSSLRI |
Gene Sequence | RFKMRRMKNVQEQSLEAGLARDLPAVLAPGKEFLQLPSIEITPSSDEDTPWSNCSTPSASPRRKRFLLRKWLRVRERKECSESSSSLRI |
Gene ID - Mouse | ENSMUSG00000040111 |
Gene ID - Rat | ENSRNOG00000053577 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRAMD1B pAb (ATL-HPA075204) | |
Datasheet | Anti GRAMD1B pAb (ATL-HPA075204) Datasheet (External Link) |
Vendor Page | Anti GRAMD1B pAb (ATL-HPA075204) at Atlas Antibodies |
Documents & Links for Anti GRAMD1B pAb (ATL-HPA075204) | |
Datasheet | Anti GRAMD1B pAb (ATL-HPA075204) Datasheet (External Link) |
Vendor Page | Anti GRAMD1B pAb (ATL-HPA075204) |