Anti GRAMD1B pAb (ATL-HPA075204)

Atlas Antibodies

Catalog No.: ATL-HPA075204-25

Protein Description: GRAM domain containing 1B
Gene Name: GRAMD1B
Alternative Gene Name: KIAA1201, LINC01059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040111: 92%, ENSRNOG00000053577: 92%
Entrez Gene ID: 57476
Uniprot ID: Q3KR37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFKMRRMKNVQEQSLEAGLARDLPAVLAPGKEFLQLPSIEITPSSDEDTPWSNCSTPSASPRRKRFLLRKWLRVRERKECSESSSSLRI
• Gene Sequence: RFKMRRMKNVQEQSLEAGLARDLPAVLAPGKEFLQLPSIEITPSSDEDTPWSNCSTPSASPRRKRFLLRKWLRVRERKECSESSSSLRI
• Gene ID - Mouse: ENSMUSG00000040111
• Gene ID - Rat: ENSRNOG00000053577
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.