Anti GRAMD1B pAb (ATL-HPA008557)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008557-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GRAMD1B
Alternative Gene Name: KIAA1201
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040111: 93%, ENSRNOG00000053577: 92%
Entrez Gene ID: 57476
Uniprot ID: Q3KR37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPKEKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSKLL |
| Gene Sequence | KNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPKEKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSKLL |
| Gene ID - Mouse | ENSMUSG00000040111 |
| Gene ID - Rat | ENSRNOG00000053577 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GRAMD1B pAb (ATL-HPA008557) | |
| Datasheet | Anti GRAMD1B pAb (ATL-HPA008557) Datasheet (External Link) |
| Vendor Page | Anti GRAMD1B pAb (ATL-HPA008557) at Atlas Antibodies |
| Documents & Links for Anti GRAMD1B pAb (ATL-HPA008557) | |
| Datasheet | Anti GRAMD1B pAb (ATL-HPA008557) Datasheet (External Link) |
| Vendor Page | Anti GRAMD1B pAb (ATL-HPA008557) |
| Citations for Anti GRAMD1B pAb (ATL-HPA008557) – 2 Found |
| Wu, Sherry Y; Yang, Xianbin; Gharpure, Kshipra M; Hatakeyama, Hiroto; Egli, Martin; McGuire, Michael H; Nagaraja, Archana S; Miyake, Takahito M; Rupaimoole, Rajesha; Pecot, Chad V; Taylor, Morgan; Pradeep, Sunila; Sierant, Malgorzata; Rodriguez-Aguayo, Cristian; Choi, Hyun J; Previs, Rebecca A; Armaiz-Pena, Guillermo N; Huang, Li; Martinez, Carlos; Hassell, Tom; Ivan, Cristina; Sehgal, Vasudha; Singhania, Richa; Han, Hee-Dong; Su, Chang; Kim, Ji Hoon; Dalton, Heather J; Kovvali, Chandra; Keyomarsi, Khandan; McMillan, Nigel A J; Overwijk, Willem W; Liu, Jinsong; Lee, Ju-Seog; Baggerly, Keith A; Lopez-Berestein, Gabriel; Ram, Prahlad T; Nawrot, Barbara; Sood, Anil K. 2'-OMe-phosphorodithioate-modified siRNAs show increased loading into the RISC complex and enhanced anti-tumour activity. Nature Communications. 2014;5( 24619206):3459. PubMed |
| Esposito, Federica; Osiceanu, Ana Maria; Sorosina, Melissa; Ottoboni, Linda; Bollman, Bryan; Santoro, Silvia; Bettegazzi, Barbara; Zauli, Andrea; Clarelli, Ferdinando; Mascia, Elisabetta; Calabria, Andrea; Zacchetti, Daniele; Capra, Ruggero; Ferrari, Maurizio; Provero, Paolo; Lazarevic, Dejan; Cittaro, Davide; Carrera, Paola; Patsopoulos, Nikolaos; Toniolo, Daniela; Sadovnick, A Dessa; Martino, Gianvito; De Jager, Philip L; Comi, Giancarlo; Stupka, Elia; Vilariño-Güell, Carles; Piccio, Laura; Martinelli Boneschi, Filippo. A Whole-Genome Sequencing Study Implicates GRAMD1B in Multiple Sclerosis Susceptibility. Genes. 2022;13(12) PubMed |