Anti GRAMD1B pAb (ATL-HPA008557)

Atlas Antibodies

Catalog No.:
ATL-HPA008557-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GRAM domain containing 1B
Gene Name: GRAMD1B
Alternative Gene Name: KIAA1201
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040111: 93%, ENSRNOG00000053577: 92%
Entrez Gene ID: 57476
Uniprot ID: Q3KR37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPKEKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSKLL
Gene Sequence KNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPKEKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSKLL
Gene ID - Mouse ENSMUSG00000040111
Gene ID - Rat ENSRNOG00000053577
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRAMD1B pAb (ATL-HPA008557)
Datasheet Anti GRAMD1B pAb (ATL-HPA008557) Datasheet (External Link)
Vendor Page Anti GRAMD1B pAb (ATL-HPA008557) at Atlas Antibodies

Documents & Links for Anti GRAMD1B pAb (ATL-HPA008557)
Datasheet Anti GRAMD1B pAb (ATL-HPA008557) Datasheet (External Link)
Vendor Page Anti GRAMD1B pAb (ATL-HPA008557)
Citations for Anti GRAMD1B pAb (ATL-HPA008557) – 2 Found
Wu, Sherry Y; Yang, Xianbin; Gharpure, Kshipra M; Hatakeyama, Hiroto; Egli, Martin; McGuire, Michael H; Nagaraja, Archana S; Miyake, Takahito M; Rupaimoole, Rajesha; Pecot, Chad V; Taylor, Morgan; Pradeep, Sunila; Sierant, Malgorzata; Rodriguez-Aguayo, Cristian; Choi, Hyun J; Previs, Rebecca A; Armaiz-Pena, Guillermo N; Huang, Li; Martinez, Carlos; Hassell, Tom; Ivan, Cristina; Sehgal, Vasudha; Singhania, Richa; Han, Hee-Dong; Su, Chang; Kim, Ji Hoon; Dalton, Heather J; Kovvali, Chandra; Keyomarsi, Khandan; McMillan, Nigel A J; Overwijk, Willem W; Liu, Jinsong; Lee, Ju-Seog; Baggerly, Keith A; Lopez-Berestein, Gabriel; Ram, Prahlad T; Nawrot, Barbara; Sood, Anil K. 2'-OMe-phosphorodithioate-modified siRNAs show increased loading into the RISC complex and enhanced anti-tumour activity. Nature Communications. 2014;5( 24619206):3459.  PubMed
Esposito, Federica; Osiceanu, Ana Maria; Sorosina, Melissa; Ottoboni, Linda; Bollman, Bryan; Santoro, Silvia; Bettegazzi, Barbara; Zauli, Andrea; Clarelli, Ferdinando; Mascia, Elisabetta; Calabria, Andrea; Zacchetti, Daniele; Capra, Ruggero; Ferrari, Maurizio; Provero, Paolo; Lazarevic, Dejan; Cittaro, Davide; Carrera, Paola; Patsopoulos, Nikolaos; Toniolo, Daniela; Sadovnick, A Dessa; Martino, Gianvito; De Jager, Philip L; Comi, Giancarlo; Stupka, Elia; Vilariño-Güell, Carles; Piccio, Laura; Martinelli Boneschi, Filippo. A Whole-Genome Sequencing Study Implicates GRAMD1B in Multiple Sclerosis Susceptibility. Genes. 2022;13(12)  PubMed