Anti GRAMD1A pAb (ATL-HPA012570 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA012570-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Western blot analysis in human cell lines A-549 and MCF-7 using Anti-GRAMD1A antibody. Corresponding GRAMD1A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GRAM domain containing 1A
Gene Name: GRAMD1A
Alternative Gene Name: FLJ90346, KIAA1533
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001248: 96%, ENSRNOG00000021106: 97%
Entrez Gene ID: 57655
Uniprot ID: Q96CP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSTGEEADLAALLPDLSGRLLINSVFHVGAERLQQMLFSDSPFLQGFLQQCKFTDVTLSPWSGDSKCHQRRVLTYTIPISNPLGPKSASVVETQTLFRRGPQAGGCVVDSEVLTQGIPYQDYFYTAHRY
Gene Sequence SSTGEEADLAALLPDLSGRLLINSVFHVGAERLQQMLFSDSPFLQGFLQQCKFTDVTLSPWSGDSKCHQRRVLTYTIPISNPLGPKSASVVETQTLFRRGPQAGGCVVDSEVLTQGIPYQDYFYTAHRY
Gene ID - Mouse ENSMUSG00000001248
Gene ID - Rat ENSRNOG00000021106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GRAMD1A pAb (ATL-HPA012570 w/enhanced validation)
Datasheet Anti GRAMD1A pAb (ATL-HPA012570 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRAMD1A pAb (ATL-HPA012570 w/enhanced validation)