Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051514-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GPT2
Alternative Gene Name: ALT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031700: 92%, ENSRNOG00000059579: 95%
Entrez Gene ID: 84706
Uniprot ID: Q8TD30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA |
| Gene Sequence | PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA |
| Gene ID - Mouse | ENSMUSG00000031700 |
| Gene ID - Rat | ENSRNOG00000059579 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation) | |
| Datasheet | Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation) | |
| Datasheet | Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation) |
| Citations for Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation) – 1 Found |
| Wei, Peng; Bott, Alex J; Cluntun, Ahmad A; Morgan, Jeffrey T; Cunningham, Corey N; Schell, John C; Ouyang, Yeyun; Ficarro, Scott B; Marto, Jarrod A; Danial, Nika N; DeBerardinis, Ralph J; Rutter, Jared. Mitochondrial pyruvate supports lymphoma proliferation by fueling a glutamate pyruvate transaminase 2-dependent glutaminolysis pathway. Science Advances. 2022;8(39):eabq0117. PubMed |