Anti GPSM1 pAb (ATL-HPA060736)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060736-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GPSM1
Alternative Gene Name: AGS3, DKFZP727I051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026930: 93%, ENSRNOG00000018666: 93%
Entrez Gene ID: 26086
Uniprot ID: Q86YR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQS |
| Gene Sequence | RKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQS |
| Gene ID - Mouse | ENSMUSG00000026930 |
| Gene ID - Rat | ENSRNOG00000018666 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GPSM1 pAb (ATL-HPA060736) | |
| Datasheet | Anti GPSM1 pAb (ATL-HPA060736) Datasheet (External Link) |
| Vendor Page | Anti GPSM1 pAb (ATL-HPA060736) at Atlas Antibodies |
| Documents & Links for Anti GPSM1 pAb (ATL-HPA060736) | |
| Datasheet | Anti GPSM1 pAb (ATL-HPA060736) Datasheet (External Link) |
| Vendor Page | Anti GPSM1 pAb (ATL-HPA060736) |