Anti GPSM1 pAb (ATL-HPA060736)

Atlas Antibodies

SKU:
ATL-HPA060736-25
  • Immunohistochemical staining of human pancreas shows strong granular positivity in exocrine glandular cells and islets of Langerhans.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein signaling modulator 1
Gene Name: GPSM1
Alternative Gene Name: AGS3, DKFZP727I051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026930: 93%, ENSRNOG00000018666: 93%
Entrez Gene ID: 26086
Uniprot ID: Q86YR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQS
Gene Sequence RKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQS
Gene ID - Mouse ENSMUSG00000026930
Gene ID - Rat ENSRNOG00000018666
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPSM1 pAb (ATL-HPA060736)
Datasheet Anti GPSM1 pAb (ATL-HPA060736) Datasheet (External Link)
Vendor Page Anti GPSM1 pAb (ATL-HPA060736) at Atlas Antibodies

Documents & Links for Anti GPSM1 pAb (ATL-HPA060736)
Datasheet Anti GPSM1 pAb (ATL-HPA060736) Datasheet (External Link)
Vendor Page Anti GPSM1 pAb (ATL-HPA060736)