Anti GPS2 pAb (ATL-HPA067540)

Atlas Antibodies

Catalog No.:
ATL-HPA067540-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein pathway suppressor 2
Gene Name: GPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023170: 94%, ENSRNOG00000016360: 95%
Entrez Gene ID: 2874
Uniprot ID: Q13227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Gene Sequence VHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Gene ID - Mouse ENSMUSG00000023170
Gene ID - Rat ENSRNOG00000016360
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPS2 pAb (ATL-HPA067540)
Datasheet Anti GPS2 pAb (ATL-HPA067540) Datasheet (External Link)
Vendor Page Anti GPS2 pAb (ATL-HPA067540) at Atlas Antibodies

Documents & Links for Anti GPS2 pAb (ATL-HPA067540)
Datasheet Anti GPS2 pAb (ATL-HPA067540) Datasheet (External Link)
Vendor Page Anti GPS2 pAb (ATL-HPA067540)