Anti GPS2 pAb (ATL-HPA067540)

Atlas Antibodies

Catalog No.: ATL-HPA067540-25

Protein Description: G protein pathway suppressor 2
Gene Name: GPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023170: 94%, ENSRNOG00000016360: 95%
Entrez Gene ID: 2874
Uniprot ID: Q13227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
• Gene Sequence: VHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
• Gene ID - Mouse: ENSMUSG00000023170
• Gene ID - Rat: ENSRNOG00000016360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.