Anti GPRIN2 pAb (ATL-HPA070760)

Atlas Antibodies

Catalog No.:
ATL-HPA070760-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein regulated inducer of neurite outgrowth 2
Gene Name: GPRIN2
Alternative Gene Name: KIAA0514, MGC15171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071531: 79%, ENSRNOG00000055042: 73%
Entrez Gene ID: 9721
Uniprot ID: O60269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVSTMGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLA
Gene Sequence NVSTMGGGDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLA
Gene ID - Mouse ENSMUSG00000071531
Gene ID - Rat ENSRNOG00000055042
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPRIN2 pAb (ATL-HPA070760)
Datasheet Anti GPRIN2 pAb (ATL-HPA070760) Datasheet (External Link)
Vendor Page Anti GPRIN2 pAb (ATL-HPA070760) at Atlas Antibodies

Documents & Links for Anti GPRIN2 pAb (ATL-HPA070760)
Datasheet Anti GPRIN2 pAb (ATL-HPA070760) Datasheet (External Link)
Vendor Page Anti GPRIN2 pAb (ATL-HPA070760)