Anti GPRC5C pAb (ATL-HPA029776 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029776-25
  • Immunohistochemistry analysis in human stomach and tonsil tissues using HPA029776 antibody. Corresponding GPRC5C RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GPRC5C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY429581).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor, class C, group 5, member C
Gene Name: GPRC5C
Alternative Gene Name: RAIG-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051043: 91%, ENSRNOG00000003144: 90%
Entrez Gene ID: 55890
Uniprot ID: Q9NQ84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRN
Gene Sequence TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRN
Gene ID - Mouse ENSMUSG00000051043
Gene ID - Rat ENSRNOG00000003144
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GPRC5C pAb (ATL-HPA029776 w/enhanced validation)
Datasheet Anti GPRC5C pAb (ATL-HPA029776 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPRC5C pAb (ATL-HPA029776 w/enhanced validation)