Anti GPRASP1 pAb (ATL-HPA031061)

Atlas Antibodies

SKU: ATL-HPA031061-25

• 

Protein Description: G protein-coupled receptor associated sorting protein 1
Gene Name: GPRASP1
Alternative Gene Name: GASP, GASP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043384: 45%, ENSRNOG00000049985: 50%
Entrez Gene ID: 9737
Uniprot ID: Q5JY77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRPRTDGERIGDSLFGAREKTSMKTGAEATSESILAADDEQVIIGSWFWASEEVNQEAEEETIFGSWFWVIDAASVESGVGVSCESRTRSEEEEVIGPWFWSGEQVD
• Gene Sequence: SRPRTDGERIGDSLFGAREKTSMKTGAEATSESILAADDEQVIIGSWFWASEEVNQEAEEETIFGSWFWVIDAASVESGVGVSCESRTRSEEEEVIGPWFWSGEQVD
• Gene ID - Mouse: ENSMUSG00000043384
• Gene ID - Rat: ENSRNOG00000049985
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.