Anti GPRASP1 pAb (ATL-HPA031061)

Atlas Antibodies

Catalog No.:
ATL-HPA031061-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor associated sorting protein 1
Gene Name: GPRASP1
Alternative Gene Name: GASP, GASP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043384: 45%, ENSRNOG00000049985: 50%
Entrez Gene ID: 9737
Uniprot ID: Q5JY77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRPRTDGERIGDSLFGAREKTSMKTGAEATSESILAADDEQVIIGSWFWASEEVNQEAEEETIFGSWFWVIDAASVESGVGVSCESRTRSEEEEVIGPWFWSGEQVD
Gene Sequence SRPRTDGERIGDSLFGAREKTSMKTGAEATSESILAADDEQVIIGSWFWASEEVNQEAEEETIFGSWFWVIDAASVESGVGVSCESRTRSEEEEVIGPWFWSGEQVD
Gene ID - Mouse ENSMUSG00000043384
Gene ID - Rat ENSRNOG00000049985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPRASP1 pAb (ATL-HPA031061)
Datasheet Anti GPRASP1 pAb (ATL-HPA031061) Datasheet (External Link)
Vendor Page Anti GPRASP1 pAb (ATL-HPA031061) at Atlas Antibodies

Documents & Links for Anti GPRASP1 pAb (ATL-HPA031061)
Datasheet Anti GPRASP1 pAb (ATL-HPA031061) Datasheet (External Link)
Vendor Page Anti GPRASP1 pAb (ATL-HPA031061)