Anti GPR65 pAb (ATL-HPA054454)

Atlas Antibodies

Catalog No.:
ATL-HPA054454-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 65
Gene Name: GPR65
Alternative Gene Name: hTDAG8, TDAG8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021886: 61%, ENSRNOG00000003806: 63%
Entrez Gene ID: 8477
Uniprot ID: Q8IYL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV
Gene Sequence ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV
Gene ID - Mouse ENSMUSG00000021886
Gene ID - Rat ENSRNOG00000003806
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR65 pAb (ATL-HPA054454)
Datasheet Anti GPR65 pAb (ATL-HPA054454) Datasheet (External Link)
Vendor Page Anti GPR65 pAb (ATL-HPA054454) at Atlas Antibodies

Documents & Links for Anti GPR65 pAb (ATL-HPA054454)
Datasheet Anti GPR65 pAb (ATL-HPA054454) Datasheet (External Link)
Vendor Page Anti GPR65 pAb (ATL-HPA054454)