Anti GPR65 pAb (ATL-HPA054454)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054454-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GPR65
Alternative Gene Name: hTDAG8, TDAG8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021886: 61%, ENSRNOG00000003806: 63%
Entrez Gene ID: 8477
Uniprot ID: Q8IYL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV |
| Gene Sequence | ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV |
| Gene ID - Mouse | ENSMUSG00000021886 |
| Gene ID - Rat | ENSRNOG00000003806 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GPR65 pAb (ATL-HPA054454) | |
| Datasheet | Anti GPR65 pAb (ATL-HPA054454) Datasheet (External Link) |
| Vendor Page | Anti GPR65 pAb (ATL-HPA054454) at Atlas Antibodies |
| Documents & Links for Anti GPR65 pAb (ATL-HPA054454) | |
| Datasheet | Anti GPR65 pAb (ATL-HPA054454) Datasheet (External Link) |
| Vendor Page | Anti GPR65 pAb (ATL-HPA054454) |