Anti GPR63 pAb (ATL-HPA039103)

Atlas Antibodies

Catalog No.:
ATL-HPA039103-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 63
Gene Name: GPR63
Alternative Gene Name: PSP24(beta), PSP24B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040372: 68%, ENSRNOG00000007675: 71%
Entrez Gene ID: 81491
Uniprot ID: Q9BZJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLTVNSTAVPTTPAAFKSLNLPLQ
Gene Sequence NTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLTVNSTAVPTTPAAFKSLNLPLQ
Gene ID - Mouse ENSMUSG00000040372
Gene ID - Rat ENSRNOG00000007675
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR63 pAb (ATL-HPA039103)
Datasheet Anti GPR63 pAb (ATL-HPA039103) Datasheet (External Link)
Vendor Page Anti GPR63 pAb (ATL-HPA039103) at Atlas Antibodies

Documents & Links for Anti GPR63 pAb (ATL-HPA039103)
Datasheet Anti GPR63 pAb (ATL-HPA039103) Datasheet (External Link)
Vendor Page Anti GPR63 pAb (ATL-HPA039103)