Anti GPR63 pAb (ATL-HPA039103)

Atlas Antibodies

SKU: ATL-HPA039103-25

• 
• 

Protein Description: G protein-coupled receptor 63
Gene Name: GPR63
Alternative Gene Name: PSP24(beta), PSP24B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040372: 68%, ENSRNOG00000007675: 71%
Entrez Gene ID: 81491
Uniprot ID: Q9BZJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLTVNSTAVPTTPAAFKSLNLPLQ
• Gene Sequence: NTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLTVNSTAVPTTPAAFKSLNLPLQ
• Gene ID - Mouse: ENSMUSG00000040372
• Gene ID - Rat: ENSRNOG00000007675
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.