Anti GPR63 pAb (ATL-HPA039103)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039103-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GPR63
Alternative Gene Name: PSP24(beta), PSP24B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040372: 68%, ENSRNOG00000007675: 71%
Entrez Gene ID: 81491
Uniprot ID: Q9BZJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLTVNSTAVPTTPAAFKSLNLPLQ |
Gene Sequence | NTTFVVYENTYMNITLPPPFQHPDLSPLLRYSFETMAPTGLSSLTVNSTAVPTTPAAFKSLNLPLQ |
Gene ID - Mouse | ENSMUSG00000040372 |
Gene ID - Rat | ENSRNOG00000007675 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GPR63 pAb (ATL-HPA039103) | |
Datasheet | Anti GPR63 pAb (ATL-HPA039103) Datasheet (External Link) |
Vendor Page | Anti GPR63 pAb (ATL-HPA039103) at Atlas Antibodies |
Documents & Links for Anti GPR63 pAb (ATL-HPA039103) | |
Datasheet | Anti GPR63 pAb (ATL-HPA039103) Datasheet (External Link) |
Vendor Page | Anti GPR63 pAb (ATL-HPA039103) |