Anti GPR20 pAb (ATL-HPA071337)

Atlas Antibodies

Catalog No.:
ATL-HPA071337-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 20
Gene Name: GPR20
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045281: 67%, ENSRNOG00000013195: 34%
Entrez Gene ID: 2843
Uniprot ID: Q99678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGP
Gene Sequence TVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGP
Gene ID - Mouse ENSMUSG00000045281
Gene ID - Rat ENSRNOG00000013195
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR20 pAb (ATL-HPA071337)
Datasheet Anti GPR20 pAb (ATL-HPA071337) Datasheet (External Link)
Vendor Page Anti GPR20 pAb (ATL-HPA071337) at Atlas Antibodies

Documents & Links for Anti GPR20 pAb (ATL-HPA071337)
Datasheet Anti GPR20 pAb (ATL-HPA071337) Datasheet (External Link)
Vendor Page Anti GPR20 pAb (ATL-HPA071337)