Anti GPR162 pAb (ATL-HPA055135 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA055135-100
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-GPR162 antibody. Corresponding GPR162 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to microtubule organizing center.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 162
Gene Name: GPR162
Alternative Gene Name: A-2, GRCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038390: 97%, ENSRNOG00000016143: 94%
Entrez Gene ID: 27239
Uniprot ID: Q16538
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYL
Gene Sequence KLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYL
Gene ID - Mouse ENSMUSG00000038390
Gene ID - Rat ENSRNOG00000016143
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GPR162 pAb (ATL-HPA055135 w/enhanced validation)
Datasheet Anti GPR162 pAb (ATL-HPA055135 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPR162 pAb (ATL-HPA055135 w/enhanced validation)