Anti GPR158 pAb (ATL-HPA013185)

Atlas Antibodies

Catalog No.: ATL-HPA013185-25

Protein Description: G protein-coupled receptor 158
Gene Name: GPR158
Alternative Gene Name: KIAA1136
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045967: 71%, ENSRNOG00000024832: 76%
Entrez Gene ID: 57512
Uniprot ID: Q5T848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGLAGKTQTAGVEERTKSQKPLPKDKETNRNHSNSDNTETKDPAPQNSNPAEEPRKPQKSGIMKQQRVNPTTANSDLNPGTTQMKDNFDIGEVCPWEVYDLTPGPVPSESKVQKHVSIVASEMEKNPTFSLKEKSHHKP
• Gene Sequence: LGLAGKTQTAGVEERTKSQKPLPKDKETNRNHSNSDNTETKDPAPQNSNPAEEPRKPQKSGIMKQQRVNPTTANSDLNPGTTQMKDNFDIGEVCPWEVYDLTPGPVPSESKVQKHVSIVASEMEKNPTFSLKEKSHHKP
• Gene ID - Mouse: ENSMUSG00000045967
• Gene ID - Rat: ENSRNOG00000024832
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GPR158 pAb (ATL-HPA013185) – 2 Found

Itakura, Tatsuo; Webster, Andrew; Chintala, Shravan K; Wang, Yuchen; Gonzalez, Jose M Jr; Tan, J C; Vranka, Janice A; Acott, Ted; Craft, Cheryl Mae; Sibug Saber, Maria E; Jeong, Shinwu; Stamer, W Daniel; Martemyanov, Kirill A; Fini, M Elizabeth. GPR158 in the Visual System: Homeostatic Role in Regulation of Intraocular Pressure. Journal Of Ocular Pharmacology And Therapeutics : The Official Journal Of The Association For Ocular Pharmacology And Therapeutics. 2019;35(4):203-215. 

Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Nemes, Szilárd; Werner Rönnerman, Elisabeth; De Lara, Shahin; Biermann, Jana; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Immunohistochemical validation of COL3A1, GPR158 and PITHD1 as prognostic biomarkers in early-stage ovarian carcinomas. Bmc Cancer. 2019;19(1):928.