Anti GPR155 pAb (ATL-HPA036159)

Atlas Antibodies

SKU: ATL-HPA036159-25

• 

Protein Description: G protein-coupled receptor 155
Gene Name: GPR155
Alternative Gene Name: DEP.7, DEPDC3, FLJ31819, PGR22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041762: 89%, ENSRNOG00000018485: 92%
Entrez Gene ID: 151556
Uniprot ID: Q7Z3F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSW
• Gene Sequence: HLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSW
• Gene ID - Mouse: ENSMUSG00000041762
• Gene ID - Rat: ENSRNOG00000018485
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.