Anti GPR152 pAb (ATL-HPA035078)

Atlas Antibodies

Catalog No.:
ATL-HPA035078-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 152
Gene Name: GPR152
Alternative Gene Name: PGR5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097905: 60%, ENSRNOG00000021912: 60%
Entrez Gene ID: 390212
Uniprot ID: Q8TDT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ
Gene Sequence DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ
Gene ID - Mouse ENSMUSG00000097905
Gene ID - Rat ENSRNOG00000021912
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR152 pAb (ATL-HPA035078)
Datasheet Anti GPR152 pAb (ATL-HPA035078) Datasheet (External Link)
Vendor Page Anti GPR152 pAb (ATL-HPA035078) at Atlas Antibodies

Documents & Links for Anti GPR152 pAb (ATL-HPA035078)
Datasheet Anti GPR152 pAb (ATL-HPA035078) Datasheet (External Link)
Vendor Page Anti GPR152 pAb (ATL-HPA035078)