Anti GPR142 pAb (ATL-HPA031392)

Atlas Antibodies

Catalog No.:
ATL-HPA031392-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 142
Gene Name: GPR142
Alternative Gene Name: PGR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054280: 29%, ENSRNOG00000056278: 27%
Entrez Gene ID: 350383
Uniprot ID: Q7Z601
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQVTGGSWDLRIRPSKDSSSFRQAQ
Gene Sequence AVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQVTGGSWDLRIRPSKDSSSFRQAQ
Gene ID - Mouse ENSMUSG00000054280
Gene ID - Rat ENSRNOG00000056278
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR142 pAb (ATL-HPA031392)
Datasheet Anti GPR142 pAb (ATL-HPA031392) Datasheet (External Link)
Vendor Page Anti GPR142 pAb (ATL-HPA031392) at Atlas Antibodies

Documents & Links for Anti GPR142 pAb (ATL-HPA031392)
Datasheet Anti GPR142 pAb (ATL-HPA031392) Datasheet (External Link)
Vendor Page Anti GPR142 pAb (ATL-HPA031392)