Anti GPR108 pAb (ATL-HPA063863)

Atlas Antibodies

Catalog No.:
ATL-HPA063863-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 108
Gene Name: GPR108
Alternative Gene Name: LUSTR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005823: 96%, ENSRNOG00000046128: 94%
Entrez Gene ID: 56927
Uniprot ID: Q9NPR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL
Gene Sequence QPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL
Gene ID - Mouse ENSMUSG00000005823
Gene ID - Rat ENSRNOG00000046128
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR108 pAb (ATL-HPA063863)
Datasheet Anti GPR108 pAb (ATL-HPA063863) Datasheet (External Link)
Vendor Page Anti GPR108 pAb (ATL-HPA063863) at Atlas Antibodies

Documents & Links for Anti GPR108 pAb (ATL-HPA063863)
Datasheet Anti GPR108 pAb (ATL-HPA063863) Datasheet (External Link)
Vendor Page Anti GPR108 pAb (ATL-HPA063863)