Anti GPLD1 pAb (ATL-HPA012500)

Atlas Antibodies

Catalog No.:
ATL-HPA012500-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glycosylphosphatidylinositol specific phospholipase D1
Gene Name: GPLD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021340: 65%, ENSRNOG00000017702: 68%
Entrez Gene ID: 2822
Uniprot ID: P80108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FWSTNIYHLTSFMLENGTSDCNLPENPLFIACGGQQNHTQGSKMQKNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRTMFIGGSQLSQKHVSS
Gene Sequence FWSTNIYHLTSFMLENGTSDCNLPENPLFIACGGQQNHTQGSKMQKNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRTMFIGGSQLSQKHVSS
Gene ID - Mouse ENSMUSG00000021340
Gene ID - Rat ENSRNOG00000017702
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPLD1 pAb (ATL-HPA012500)
Datasheet Anti GPLD1 pAb (ATL-HPA012500) Datasheet (External Link)
Vendor Page Anti GPLD1 pAb (ATL-HPA012500) at Atlas Antibodies

Documents & Links for Anti GPLD1 pAb (ATL-HPA012500)
Datasheet Anti GPLD1 pAb (ATL-HPA012500) Datasheet (External Link)
Vendor Page Anti GPLD1 pAb (ATL-HPA012500)