Anti GPER1 pAb (ATL-HPA027052)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027052-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GPER1
Alternative Gene Name: CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053647: 56%, ENSRNOG00000001287: 55%
Entrez Gene ID: 2852
Uniprot ID: Q99527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS |
Gene Sequence | MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS |
Gene ID - Mouse | ENSMUSG00000053647 |
Gene ID - Rat | ENSRNOG00000001287 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GPER1 pAb (ATL-HPA027052) | |
Datasheet | Anti GPER1 pAb (ATL-HPA027052) Datasheet (External Link) |
Vendor Page | Anti GPER1 pAb (ATL-HPA027052) at Atlas Antibodies |
Documents & Links for Anti GPER1 pAb (ATL-HPA027052) | |
Datasheet | Anti GPER1 pAb (ATL-HPA027052) Datasheet (External Link) |
Vendor Page | Anti GPER1 pAb (ATL-HPA027052) |
Citations for Anti GPER1 pAb (ATL-HPA027052) – 5 Found |
Natale, Christopher A; Li, Jinyang; Zhang, Junqian; Dahal, Ankit; Dentchev, Tzvete; Stanger, Ben Z; Ridky, Todd W. Activation of G protein-coupled estrogen receptor signaling inhibits melanoma and improves response to immune checkpoint blockade. Elife. 2018;7( 29336307) PubMed |
Liu, Mei; Du, Yaqi; Li, Haiwen; Wang, Li; Ponikwicka-Tyszko, Donata; Lebiedzinska, Weronika; Pilaszewicz-Puza, Agata; Liu, Huijiao; Zhou, Lijun; Fan, Hanlu; Wang, Mingming; You, Hua; Wolczynnski, Slawomir; Rahman, Nafis; Guo, Yang-Dong; Li, Xiangdong. Cyanidin-3-o-Glucoside Pharmacologically Inhibits Tumorigenesis via Estrogen Receptor β in Melanoma Mice. Frontiers In Oncology. 9( 31696058):1110. PubMed |
Natale, Christopher A; Li, Jinyang; Pitarresi, Jason R; Norgard, Robert J; Dentchev, Tzvete; Capell, Brian C; Seykora, John T; Stanger, Ben Z; Ridky, Todd W. Pharmacologic Activation of the G Protein-Coupled Estrogen Receptor Inhibits Pancreatic Ductal Adenocarcinoma. Cellular And Molecular Gastroenterology And Hepatology. 10(4):868-880.e1. PubMed |
Yamamoto, Asako; Yang, Lingli; Kuroda, Yasutaka; Guo, Jiao; Teng, Lanting; Tsuruta, Daisuke; Katayama, Ichiro. Local Epidermal Endocrine Estrogen Protects Human Melanocytes against Oxidative Stress, a Novel Insight into Vitiligo Pathology. International Journal Of Molecular Sciences. 2020;22(1) PubMed |
Florido, Antonio; Moreno, Estefanía; Canela, Enric I; Andero, Raül. Nk3R blockade has sex-divergent effects on memory in mice. Biology Of Sex Differences. 2022;13(1):28. PubMed |