Anti GPER1 pAb (ATL-HPA016718)

Atlas Antibodies

SKU:
ATL-HPA016718-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm, nucleoli, cytosol & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: G protein-coupled estrogen receptor 1
Gene Name: GPER1
Alternative Gene Name: CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053647: 56%, ENSRNOG00000001287: 55%
Entrez Gene ID: 2852
Uniprot ID: Q99527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
Gene Sequence MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
Gene ID - Mouse ENSMUSG00000053647
Gene ID - Rat ENSRNOG00000001287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPER1 pAb (ATL-HPA016718)
Datasheet Anti GPER1 pAb (ATL-HPA016718) Datasheet (External Link)
Vendor Page Anti GPER1 pAb (ATL-HPA016718) at Atlas Antibodies

Documents & Links for Anti GPER1 pAb (ATL-HPA016718)
Datasheet Anti GPER1 pAb (ATL-HPA016718) Datasheet (External Link)
Vendor Page Anti GPER1 pAb (ATL-HPA016718)