Anti GPD2 pAb (ATL-HPA008012 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008012-25

Protein Description: glycerol-3-phosphate dehydrogenase 2 (mitochondrial)
Gene Name: GPD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026827: 79%, ENSRNOG00000033824: 87%
Entrez Gene ID: 2820
Uniprot ID: P43304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQNTSEFDILVIGGGATGSG
• Gene Sequence: RRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQNTSEFDILVIGGGATGSG
• Gene ID - Mouse: ENSMUSG00000026827
• Gene ID - Rat: ENSRNOG00000033824
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.