Anti GPD2 pAb (ATL-HPA008012 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA008012-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glycerol-3-phosphate dehydrogenase 2 (mitochondrial)
Gene Name: GPD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026827: 79%, ENSRNOG00000033824: 87%
Entrez Gene ID: 2820
Uniprot ID: P43304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQNTSEFDILVIGGGATGSG
Gene Sequence RRKQMNLAYVKAADCISEPVNREPPSREAQLLTLQNTSEFDILVIGGGATGSG
Gene ID - Mouse ENSMUSG00000026827
Gene ID - Rat ENSRNOG00000033824
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPD2 pAb (ATL-HPA008012 w/enhanced validation)
Datasheet Anti GPD2 pAb (ATL-HPA008012 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPD2 pAb (ATL-HPA008012 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GPD2 pAb (ATL-HPA008012 w/enhanced validation)
Datasheet Anti GPD2 pAb (ATL-HPA008012 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPD2 pAb (ATL-HPA008012 w/enhanced validation)