Anti GPC4 pAb (ATL-HPA030836)

Atlas Antibodies

SKU:
ATL-HPA030836-25
  • Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glypican 4
Gene Name: GPC4
Alternative Gene Name: K-glypican
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031119: 93%, ENSRNOG00000002413: 93%
Entrez Gene ID: 2239
Uniprot ID: O75487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKMKNAYNGNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVR
Gene Sequence SKMKNAYNGNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVR
Gene ID - Mouse ENSMUSG00000031119
Gene ID - Rat ENSRNOG00000002413
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPC4 pAb (ATL-HPA030836)
Datasheet Anti GPC4 pAb (ATL-HPA030836) Datasheet (External Link)
Vendor Page Anti GPC4 pAb (ATL-HPA030836) at Atlas Antibodies

Documents & Links for Anti GPC4 pAb (ATL-HPA030836)
Datasheet Anti GPC4 pAb (ATL-HPA030836) Datasheet (External Link)
Vendor Page Anti GPC4 pAb (ATL-HPA030836)