Anti GPC3 pAb (ATL-HPA006316)

Atlas Antibodies

SKU: ATL-HPA006316-25

• 

Protein Description: glypican 3
Gene Name: GPC3
Alternative Gene Name: DGSX, OCI-5, SDYS, SGB, SGBS, SGBS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055653: 81%, ENSRNOG00000060179: 81%
Entrez Gene ID: 2719
Uniprot ID: P51654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMA
• Gene Sequence: DKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMA
• Gene ID - Mouse: ENSMUSG00000055653
• Gene ID - Rat: ENSRNOG00000060179
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GPC3 pAb (ATL-HPA006316) – 1 Found

Knelson, Erik H; Gaviglio, Angela L; Nee, Jasmine C; Starr, Mark D; Nixon, Andrew B; Marcus, Stephen G; Blobe, Gerard C. Stromal heparan sulfate differentiates neuroblasts to suppress neuroblastoma growth. The Journal Of Clinical Investigation. 2014;124(7):3016-31.