Anti GPC3 pAb (ATL-HPA006316)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006316-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GPC3
Alternative Gene Name: DGSX, OCI-5, SDYS, SGB, SGBS, SGBS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055653: 81%, ENSRNOG00000060179: 81%
Entrez Gene ID: 2719
Uniprot ID: P51654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMA |
Gene Sequence | DKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMA |
Gene ID - Mouse | ENSMUSG00000055653 |
Gene ID - Rat | ENSRNOG00000060179 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GPC3 pAb (ATL-HPA006316) | |
Datasheet | Anti GPC3 pAb (ATL-HPA006316) Datasheet (External Link) |
Vendor Page | Anti GPC3 pAb (ATL-HPA006316) at Atlas Antibodies |
Documents & Links for Anti GPC3 pAb (ATL-HPA006316) | |
Datasheet | Anti GPC3 pAb (ATL-HPA006316) Datasheet (External Link) |
Vendor Page | Anti GPC3 pAb (ATL-HPA006316) |
Citations for Anti GPC3 pAb (ATL-HPA006316) – 1 Found |
Knelson, Erik H; Gaviglio, Angela L; Nee, Jasmine C; Starr, Mark D; Nixon, Andrew B; Marcus, Stephen G; Blobe, Gerard C. Stromal heparan sulfate differentiates neuroblasts to suppress neuroblastoma growth. The Journal Of Clinical Investigation. 2014;124(7):3016-31. PubMed |