Anti GPATCH4 pAb (ATL-HPA054319)

Atlas Antibodies

Catalog No.:
ATL-HPA054319-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: G patch domain containing 4
Gene Name: GPATCH4
Alternative Gene Name: DKFZP434F1735, FLJ20249, GPATC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028069: 85%, ENSRNOG00000018969: 89%
Entrez Gene ID: 54865
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRY
Gene Sequence RGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRY
Gene ID - Mouse ENSMUSG00000028069
Gene ID - Rat ENSRNOG00000018969
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPATCH4 pAb (ATL-HPA054319)
Datasheet Anti GPATCH4 pAb (ATL-HPA054319) Datasheet (External Link)
Vendor Page Anti GPATCH4 pAb (ATL-HPA054319) at Atlas Antibodies

Documents & Links for Anti GPATCH4 pAb (ATL-HPA054319)
Datasheet Anti GPATCH4 pAb (ATL-HPA054319) Datasheet (External Link)
Vendor Page Anti GPATCH4 pAb (ATL-HPA054319)