Anti GPATCH4 pAb (ATL-HPA028323)

Atlas Antibodies

SKU:
ATL-HPA028323-25
  • Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G patch domain containing 4
Gene Name: GPATCH4
Alternative Gene Name: DKFZP434F1735, FLJ20249, GPATC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028069: 36%, ENSRNOG00000018969: 46%
Entrez Gene ID: 54865
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TASERNDADEKHPEHAEQNIRKSKKKKRRHQEGKVSDEREGTTKGNEKEDAAGTSGLGELNSREQTNQSLRKGKKKKRWHHEEEKMGVLEEGGKGKEAAGSVRT
Gene Sequence TASERNDADEKHPEHAEQNIRKSKKKKRRHQEGKVSDEREGTTKGNEKEDAAGTSGLGELNSREQTNQSLRKGKKKKRWHHEEEKMGVLEEGGKGKEAAGSVRT
Gene ID - Mouse ENSMUSG00000028069
Gene ID - Rat ENSRNOG00000018969
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPATCH4 pAb (ATL-HPA028323)
Datasheet Anti GPATCH4 pAb (ATL-HPA028323) Datasheet (External Link)
Vendor Page Anti GPATCH4 pAb (ATL-HPA028323) at Atlas Antibodies

Documents & Links for Anti GPATCH4 pAb (ATL-HPA028323)
Datasheet Anti GPATCH4 pAb (ATL-HPA028323) Datasheet (External Link)
Vendor Page Anti GPATCH4 pAb (ATL-HPA028323)