Anti GPATCH3 pAb (ATL-HPA054973)

Atlas Antibodies

Catalog No.:
ATL-HPA054973-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: G patch domain containing 3
Gene Name: GPATCH3
Alternative Gene Name: FLJ12455, GPATC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028850: 93%, ENSRNOG00000007097: 89%
Entrez Gene ID: 63906
Uniprot ID: Q96I76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHTKGIGRKVMERQGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKLQPFGQLKRPRRNGLGLISTIYDEPLPQDQTES
Gene Sequence RHTKGIGRKVMERQGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKLQPFGQLKRPRRNGLGLISTIYDEPLPQDQTES
Gene ID - Mouse ENSMUSG00000028850
Gene ID - Rat ENSRNOG00000007097
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPATCH3 pAb (ATL-HPA054973)
Datasheet Anti GPATCH3 pAb (ATL-HPA054973) Datasheet (External Link)
Vendor Page Anti GPATCH3 pAb (ATL-HPA054973) at Atlas Antibodies

Documents & Links for Anti GPATCH3 pAb (ATL-HPA054973)
Datasheet Anti GPATCH3 pAb (ATL-HPA054973) Datasheet (External Link)
Vendor Page Anti GPATCH3 pAb (ATL-HPA054973)