Anti GPATCH3 pAb (ATL-HPA032078 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA032078-25
  • Immunohistochemical staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GPATCH3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411801).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G patch domain containing 3
Gene Name: GPATCH3
Alternative Gene Name: FLJ12455, GPATC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028850: 73%, ENSRNOG00000007097: 72%
Entrez Gene ID: 63906
Uniprot ID: Q96I76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNSALIPTDPAAEGQLLSQTSATDVRPLSTRDSTPIQTRTCCCVISVRGLAQAQRLIRMYSGRRWLDSHGTWLPGRCLIRRLRLPTEASGLGSFPFKTRKEL
Gene Sequence PNSALIPTDPAAEGQLLSQTSATDVRPLSTRDSTPIQTRTCCCVISVRGLAQAQRLIRMYSGRRWLDSHGTWLPGRCLIRRLRLPTEASGLGSFPFKTRKEL
Gene ID - Mouse ENSMUSG00000028850
Gene ID - Rat ENSRNOG00000007097
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GPATCH3 pAb (ATL-HPA032078 w/enhanced validation)
Datasheet Anti GPATCH3 pAb (ATL-HPA032078 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPATCH3 pAb (ATL-HPA032078 w/enhanced validation)



Citations for Anti GPATCH3 pAb (ATL-HPA032078 w/enhanced validation) – 2 Found
Ferre-Fernández, Jesús-José; Aroca-Aguilar, José-Daniel; Medina-Trillo, Cristina; Bonet-Fernández, Juan-Manuel; Méndez-Hernández, Carmen-Dora; Morales-Fernández, Laura; Corton, Marta; Cabañero-Valera, María-José; Gut, Marta; Tonda, Raul; Ayuso, Carmen; Coca-Prados, Miguel; García-Feijoo, Julián; Escribano, Julio. Whole-Exome Sequencing of Congenital Glaucoma Patients Reveals Hypermorphic Variants in GPATCH3, a New Gene Involved in Ocular and Craniofacial Development. Scientific Reports. 2017;7( 28397860):46175.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed