Anti GPATCH2 pAb (ATL-HPA027181)

Atlas Antibodies

SKU:
ATL-HPA027181-25
  • Immunohistochemical staining of human testis shows nuclear positivity in cells in seminiferous ducts and Leydig cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G patch domain containing 2
Gene Name: GPATCH2
Alternative Gene Name: CT110, FLJ10252, GPATC2, PPP1R30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039210: 82%, ENSRNOG00000002512: 75%
Entrez Gene ID: 55105
Uniprot ID: Q9NW75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NDEGRQGDDEQSDWFYEKESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMVPIPGPV
Gene Sequence NDEGRQGDDEQSDWFYEKESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMVPIPGPV
Gene ID - Mouse ENSMUSG00000039210
Gene ID - Rat ENSRNOG00000002512
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPATCH2 pAb (ATL-HPA027181)
Datasheet Anti GPATCH2 pAb (ATL-HPA027181) Datasheet (External Link)
Vendor Page Anti GPATCH2 pAb (ATL-HPA027181) at Atlas Antibodies

Documents & Links for Anti GPATCH2 pAb (ATL-HPA027181)
Datasheet Anti GPATCH2 pAb (ATL-HPA027181) Datasheet (External Link)
Vendor Page Anti GPATCH2 pAb (ATL-HPA027181)