Anti GPAA1 pAb (ATL-HPA077224)

Atlas Antibodies

Catalog No.:
ATL-HPA077224-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: glycosylphosphatidylinositol anchor attachment 1
Gene Name: GPAA1
Alternative Gene Name: GAA1, hGAA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022561: 95%, ENSRNOG00000029280: 95%
Entrez Gene ID: 8733
Uniprot ID: O43292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQSSPLQGRAGAIQAAVALELSSDVVTSLDVAVEGLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPEDWTSLDGPL
Gene Sequence MQSSPLQGRAGAIQAAVALELSSDVVTSLDVAVEGLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPEDWTSLDGPL
Gene ID - Mouse ENSMUSG00000022561
Gene ID - Rat ENSRNOG00000029280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPAA1 pAb (ATL-HPA077224)
Datasheet Anti GPAA1 pAb (ATL-HPA077224) Datasheet (External Link)
Vendor Page Anti GPAA1 pAb (ATL-HPA077224) at Atlas Antibodies

Documents & Links for Anti GPAA1 pAb (ATL-HPA077224)
Datasheet Anti GPAA1 pAb (ATL-HPA077224) Datasheet (External Link)
Vendor Page Anti GPAA1 pAb (ATL-HPA077224)