Anti GP9 pAb (ATL-HPA063182)

Atlas Antibodies

Catalog No.:
ATL-HPA063182-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glycoprotein IX (platelet)
Gene Name: GP9
Alternative Gene Name: CD42a, GPIX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030054: 82%, ENSRNOG00000010015: 76%
Entrez Gene ID: 2815
Uniprot ID: P14770
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGLTALPALPARTRHLLLANNSLQSVPPGAFDHLPQLQTLDVTQNPWHCDC
Gene Sequence HGLTALPALPARTRHLLLANNSLQSVPPGAFDHLPQLQTLDVTQNPWHCDC
Gene ID - Mouse ENSMUSG00000030054
Gene ID - Rat ENSRNOG00000010015
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GP9 pAb (ATL-HPA063182)
Datasheet Anti GP9 pAb (ATL-HPA063182) Datasheet (External Link)
Vendor Page Anti GP9 pAb (ATL-HPA063182) at Atlas Antibodies

Documents & Links for Anti GP9 pAb (ATL-HPA063182)
Datasheet Anti GP9 pAb (ATL-HPA063182) Datasheet (External Link)
Vendor Page Anti GP9 pAb (ATL-HPA063182)