Anti GP6 pAb (ATL-HPA066482)

Atlas Antibodies

Catalog No.:
ATL-HPA066482-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glycoprotein VI (platelet)
Gene Name: GP6
Alternative Gene Name: GPVI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078810: 78%, ENSRNOG00000047204: 65%
Entrez Gene ID: 51206
Uniprot ID: Q9HCN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQL
Gene Sequence VTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQL
Gene ID - Mouse ENSMUSG00000078810
Gene ID - Rat ENSRNOG00000047204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GP6 pAb (ATL-HPA066482)
Datasheet Anti GP6 pAb (ATL-HPA066482) Datasheet (External Link)
Vendor Page Anti GP6 pAb (ATL-HPA066482) at Atlas Antibodies

Documents & Links for Anti GP6 pAb (ATL-HPA066482)
Datasheet Anti GP6 pAb (ATL-HPA066482) Datasheet (External Link)
Vendor Page Anti GP6 pAb (ATL-HPA066482)