Anti GP5 pAb (ATL-HPA072646)

Atlas Antibodies

Catalog No.:
ATL-HPA072646-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glycoprotein V platelet
Gene Name: GP5
Alternative Gene Name: CD42d
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047953: 77%, ENSRNOG00000061705: 78%
Entrez Gene ID: 2814
Uniprot ID: P40197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLP
Gene Sequence GNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLP
Gene ID - Mouse ENSMUSG00000047953
Gene ID - Rat ENSRNOG00000061705
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GP5 pAb (ATL-HPA072646)
Datasheet Anti GP5 pAb (ATL-HPA072646) Datasheet (External Link)
Vendor Page Anti GP5 pAb (ATL-HPA072646) at Atlas Antibodies

Documents & Links for Anti GP5 pAb (ATL-HPA072646)
Datasheet Anti GP5 pAb (ATL-HPA072646) Datasheet (External Link)
Vendor Page Anti GP5 pAb (ATL-HPA072646)