Anti GP5 pAb (ATL-HPA072646)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072646-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GP5
Alternative Gene Name: CD42d
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047953: 77%, ENSRNOG00000061705: 78%
Entrez Gene ID: 2814
Uniprot ID: P40197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLP |
| Gene Sequence | GNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLP |
| Gene ID - Mouse | ENSMUSG00000047953 |
| Gene ID - Rat | ENSRNOG00000061705 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GP5 pAb (ATL-HPA072646) | |
| Datasheet | Anti GP5 pAb (ATL-HPA072646) Datasheet (External Link) |
| Vendor Page | Anti GP5 pAb (ATL-HPA072646) at Atlas Antibodies |
| Documents & Links for Anti GP5 pAb (ATL-HPA072646) | |
| Datasheet | Anti GP5 pAb (ATL-HPA072646) Datasheet (External Link) |
| Vendor Page | Anti GP5 pAb (ATL-HPA072646) |