Anti GOT1 pAb (ATL-HPA072629 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072629-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: GOT1
Alternative Gene Name: AST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025190: 96%, ENSRNOG00000016356: 91%
Entrez Gene ID: 2805
Uniprot ID: P17174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ |
Gene Sequence | IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ |
Gene ID - Mouse | ENSMUSG00000025190 |
Gene ID - Rat | ENSRNOG00000016356 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GOT1 pAb (ATL-HPA072629 w/enhanced validation) | |
Datasheet | Anti GOT1 pAb (ATL-HPA072629 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GOT1 pAb (ATL-HPA072629 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GOT1 pAb (ATL-HPA072629 w/enhanced validation) | |
Datasheet | Anti GOT1 pAb (ATL-HPA072629 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GOT1 pAb (ATL-HPA072629 w/enhanced validation) |