Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA064532-25
  • Immunohistochemistry analysis in human heart muscle and lymph node tissues using Anti-GOT1 antibody. Corresponding GOT1 RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-GOT1 antibody HPA064532 (A) shows similar pattern to independent antibody HPA072629 (B).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glutamic-oxaloacetic transaminase 1, soluble
Gene Name: GOT1
Alternative Gene Name: AST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025190: 92%, ENSRNOG00000016356: 95%
Entrez Gene ID: 2805
Uniprot ID: P17174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH
Gene Sequence RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH
Gene ID - Mouse ENSMUSG00000025190
Gene ID - Rat ENSRNOG00000016356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)
Datasheet Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)
Datasheet Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOT1 pAb (ATL-HPA064532 w/enhanced validation)