Anti GOSR2 pAb (ATL-HPA048956)

Atlas Antibodies

Catalog No.:
ATL-HPA048956-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: golgi SNAP receptor complex member 2
Gene Name: GOSR2
Alternative Gene Name: Bos1, GS27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020946: 85%, ENSRNOG00000003506: 91%
Entrez Gene ID: 9570
Uniprot ID: O14653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQG
Gene Sequence PLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQG
Gene ID - Mouse ENSMUSG00000020946
Gene ID - Rat ENSRNOG00000003506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GOSR2 pAb (ATL-HPA048956)
Datasheet Anti GOSR2 pAb (ATL-HPA048956) Datasheet (External Link)
Vendor Page Anti GOSR2 pAb (ATL-HPA048956) at Atlas Antibodies

Documents & Links for Anti GOSR2 pAb (ATL-HPA048956)
Datasheet Anti GOSR2 pAb (ATL-HPA048956) Datasheet (External Link)
Vendor Page Anti GOSR2 pAb (ATL-HPA048956)