Anti GORAB pAb (ATL-HPA027250 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027250-25

Protein Description: golgin, RAB6-interacting
Gene Name: GORAB
Alternative Gene Name: FLJ11752, GO, NTKL-BP1, SCYL1BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040124: 68%, ENSRNOG00000003861: 71%
Entrez Gene ID: 92344
Uniprot ID: Q5T7V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLME
• Gene Sequence: FSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLME
• Gene ID - Mouse: ENSMUSG00000040124
• Gene ID - Rat: ENSRNOG00000003861
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GORAB pAb (ATL-HPA027250 w/enhanced validation) – 2 Found

Kovacs, Levente; Chao-Chu, Jennifer; Schneider, Sandra; Gottardo, Marco; Tzolovsky, George; Dzhindzhev, Nikola S; Riparbelli, Maria Giovanna; Callaini, Giuliano; Glover, David M. Gorab is a Golgi protein required for structure and duplication of Drosophila centrioles. Nature Genetics. 2018;50(7):1021-1031. 

Kaeser-Pebernard, Stéphanie; Vionnet, Christine; Mari, Muriel; Sankar, Devanarayanan Siva; Hu, Zehan; Roubaty, Carole; Martínez-Martínez, Esther; Zhao, Huiyuan; Spuch-Calvar, Miguel; Petri-Fink, Alke; Rainer, Gregor; Steinberg, Florian; Reggiori, Fulvio; Dengjel, Jörn. mTORC1 controls Golgi architecture and vesicle secretion by phosphorylation of SCYL1. Nature Communications. 2022;13(1):4685.