Anti GORAB pAb (ATL-HPA027208)

Atlas Antibodies

Catalog No.:
ATL-HPA027208-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: golgin, RAB6-interacting
Gene Name: GORAB
Alternative Gene Name: FLJ11752, GO, NTKL-BP1, SCYL1BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040124: 66%, ENSRNOG00000003861: 67%
Entrez Gene ID: 92344
Uniprot ID: Q5T7V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAP
Gene Sequence MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAP
Gene ID - Mouse ENSMUSG00000040124
Gene ID - Rat ENSRNOG00000003861
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GORAB pAb (ATL-HPA027208)
Datasheet Anti GORAB pAb (ATL-HPA027208) Datasheet (External Link)
Vendor Page Anti GORAB pAb (ATL-HPA027208) at Atlas Antibodies

Documents & Links for Anti GORAB pAb (ATL-HPA027208)
Datasheet Anti GORAB pAb (ATL-HPA027208) Datasheet (External Link)
Vendor Page Anti GORAB pAb (ATL-HPA027208)