Anti GORAB pAb (ATL-HPA027208)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027208-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GORAB
Alternative Gene Name: FLJ11752, GO, NTKL-BP1, SCYL1BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040124: 66%, ENSRNOG00000003861: 67%
Entrez Gene ID: 92344
Uniprot ID: Q5T7V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAP |
Gene Sequence | MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAP |
Gene ID - Mouse | ENSMUSG00000040124 |
Gene ID - Rat | ENSRNOG00000003861 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GORAB pAb (ATL-HPA027208) | |
Datasheet | Anti GORAB pAb (ATL-HPA027208) Datasheet (External Link) |
Vendor Page | Anti GORAB pAb (ATL-HPA027208) at Atlas Antibodies |
Documents & Links for Anti GORAB pAb (ATL-HPA027208) | |
Datasheet | Anti GORAB pAb (ATL-HPA027208) Datasheet (External Link) |
Vendor Page | Anti GORAB pAb (ATL-HPA027208) |