Anti GOPC pAb (ATL-HPA019477)

Atlas Antibodies

Catalog No.:
ATL-HPA019477-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: golgi-associated PDZ and coiled-coil motif containing
Gene Name: GOPC
Alternative Gene Name: CAL, dJ94G16.2, FIG, GOPC1, PIST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019861: 100%, ENSRNOG00000000408: 98%
Entrez Gene ID: 57120
Uniprot ID: Q9HD26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ
Gene Sequence NDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ
Gene ID - Mouse ENSMUSG00000019861
Gene ID - Rat ENSRNOG00000000408
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GOPC pAb (ATL-HPA019477)
Datasheet Anti GOPC pAb (ATL-HPA019477) Datasheet (External Link)
Vendor Page Anti GOPC pAb (ATL-HPA019477) at Atlas Antibodies

Documents & Links for Anti GOPC pAb (ATL-HPA019477)
Datasheet Anti GOPC pAb (ATL-HPA019477) Datasheet (External Link)
Vendor Page Anti GOPC pAb (ATL-HPA019477)