Anti GON4L pAb (ATL-HPA074504)

Atlas Antibodies

Catalog No.:
ATL-HPA074504-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: gon-4-like (C. elegans)
Gene Name: GON4L
Alternative Gene Name: FLJ20203, GON-4, GON4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054199: 93%, ENSRNOG00000020297: 93%
Entrez Gene ID: 54856
Uniprot ID: Q3T8J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVCMDSFQPMDDSLIAFQTRSKMPLKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKMWLGGLMNDDVGNEDE
Gene Sequence PVCMDSFQPMDDSLIAFQTRSKMPLKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKMWLGGLMNDDVGNEDE
Gene ID - Mouse ENSMUSG00000054199
Gene ID - Rat ENSRNOG00000020297
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GON4L pAb (ATL-HPA074504)
Datasheet Anti GON4L pAb (ATL-HPA074504) Datasheet (External Link)
Vendor Page Anti GON4L pAb (ATL-HPA074504) at Atlas Antibodies

Documents & Links for Anti GON4L pAb (ATL-HPA074504)
Datasheet Anti GON4L pAb (ATL-HPA074504) Datasheet (External Link)
Vendor Page Anti GON4L pAb (ATL-HPA074504)