Anti GON4L pAb (ATL-HPA074504)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074504-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GON4L
Alternative Gene Name: FLJ20203, GON-4, GON4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054199: 93%, ENSRNOG00000020297: 93%
Entrez Gene ID: 54856
Uniprot ID: Q3T8J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PVCMDSFQPMDDSLIAFQTRSKMPLKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKMWLGGLMNDDVGNEDE |
| Gene Sequence | PVCMDSFQPMDDSLIAFQTRSKMPLKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKMWLGGLMNDDVGNEDE |
| Gene ID - Mouse | ENSMUSG00000054199 |
| Gene ID - Rat | ENSRNOG00000020297 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GON4L pAb (ATL-HPA074504) | |
| Datasheet | Anti GON4L pAb (ATL-HPA074504) Datasheet (External Link) |
| Vendor Page | Anti GON4L pAb (ATL-HPA074504) at Atlas Antibodies |
| Documents & Links for Anti GON4L pAb (ATL-HPA074504) | |
| Datasheet | Anti GON4L pAb (ATL-HPA074504) Datasheet (External Link) |
| Vendor Page | Anti GON4L pAb (ATL-HPA074504) |