Anti GNS pAb (ATL-HPA013695 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA013695-100
  • Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in granular pattern.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GNS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419554).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: glucosamine (N-acetyl)-6-sulfatase
Gene Name: GNS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034707: 94%, ENSRNOG00000047350: 93%
Entrez Gene ID: 2799
Uniprot ID: P15586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRF
Gene Sequence DVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRF
Gene ID - Mouse ENSMUSG00000034707
Gene ID - Rat ENSRNOG00000047350
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GNS pAb (ATL-HPA013695 w/enhanced validation)
Datasheet Anti GNS pAb (ATL-HPA013695 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNS pAb (ATL-HPA013695 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GNS pAb (ATL-HPA013695 w/enhanced validation)
Datasheet Anti GNS pAb (ATL-HPA013695 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNS pAb (ATL-HPA013695 w/enhanced validation)