Anti GNS pAb (ATL-HPA013695 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013695-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GNS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034707: 94%, ENSRNOG00000047350: 93%
Entrez Gene ID: 2799
Uniprot ID: P15586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRF |
| Gene Sequence | DVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRF |
| Gene ID - Mouse | ENSMUSG00000034707 |
| Gene ID - Rat | ENSRNOG00000047350 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GNS pAb (ATL-HPA013695 w/enhanced validation) | |
| Datasheet | Anti GNS pAb (ATL-HPA013695 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GNS pAb (ATL-HPA013695 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GNS pAb (ATL-HPA013695 w/enhanced validation) | |
| Datasheet | Anti GNS pAb (ATL-HPA013695 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GNS pAb (ATL-HPA013695 w/enhanced validation) |