Anti GNLY pAb (ATL-HPA058021 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA058021-25

Protein Description: granulysin
Gene Name: GNLY
Alternative Gene Name: D2S69E, LAG-2, LAG2, NKG5, TLA519
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034898: 28%, ENSRNOG00000011521: 28%
Entrez Gene ID: 10578
Uniprot ID: P22749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKP
• Gene Sequence: RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKP
• Gene ID - Mouse: ENSMUSG00000034898
• Gene ID - Rat: ENSRNOG00000011521
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.