Anti GNL2 pAb (ATL-HPA060026)

Atlas Antibodies

Catalog No.:
ATL-HPA060026-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein-like 2 (nucleolar)
Gene Name: GNL2
Alternative Gene Name: HUMAUANTIG, Ngp-1, Nog2, Nug2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028869: 99%, ENSRNOG00000009430: 99%
Entrez Gene ID: 29889
Uniprot ID: Q13823
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NAEMSTESYDQGKDRDLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPH
Gene Sequence NAEMSTESYDQGKDRDLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPH
Gene ID - Mouse ENSMUSG00000028869
Gene ID - Rat ENSRNOG00000009430
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GNL2 pAb (ATL-HPA060026)
Datasheet Anti GNL2 pAb (ATL-HPA060026) Datasheet (External Link)
Vendor Page Anti GNL2 pAb (ATL-HPA060026) at Atlas Antibodies

Documents & Links for Anti GNL2 pAb (ATL-HPA060026)
Datasheet Anti GNL2 pAb (ATL-HPA060026) Datasheet (External Link)
Vendor Page Anti GNL2 pAb (ATL-HPA060026)