Anti GNL2 pAb (ATL-HPA060026)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060026-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GNL2
Alternative Gene Name: HUMAUANTIG, Ngp-1, Nog2, Nug2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028869: 99%, ENSRNOG00000009430: 99%
Entrez Gene ID: 29889
Uniprot ID: Q13823
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NAEMSTESYDQGKDRDLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPH |
| Gene Sequence | NAEMSTESYDQGKDRDLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPH |
| Gene ID - Mouse | ENSMUSG00000028869 |
| Gene ID - Rat | ENSRNOG00000009430 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GNL2 pAb (ATL-HPA060026) | |
| Datasheet | Anti GNL2 pAb (ATL-HPA060026) Datasheet (External Link) |
| Vendor Page | Anti GNL2 pAb (ATL-HPA060026) at Atlas Antibodies |
| Documents & Links for Anti GNL2 pAb (ATL-HPA060026) | |
| Datasheet | Anti GNL2 pAb (ATL-HPA060026) Datasheet (External Link) |
| Vendor Page | Anti GNL2 pAb (ATL-HPA060026) |