Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA003534-25

• 
• 
• 

Protein Description: guanine nucleotide binding protein (G protein), gamma 2
Gene Name: GNG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043004: 100%, ENSRNOG00000019570: 79%
Entrez Gene ID: 54331
Uniprot ID: P59768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREK
• Gene Sequence: ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREK
• Gene ID - Mouse: ENSMUSG00000043004
• Gene ID - Rat: ENSRNOG00000019570
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) – 2 Found

Pirone, Andrea; Cozzi, Bruno; Edelstein, Larry; Peruffo, Antonella; Lenzi, Carla; Quilici, Francesca; Antonini, Rita; Castagna, Maura. Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum. Plos One. 7(9):e44745. 

Cozzi, Bruno; Roncon, Giulia; Granato, Alberto; Giurisato, Maristella; Castagna, Maura; Peruffo, Antonella; Panin, Mattia; Ballarin, Cristina; Montelli, Stefano; Pirone, Andrea. The claustrum of the bottlenose dolphin Tursiops truncatus (Montagu 1821). Frontiers In Systems Neuroscience. 8( 24734007):42.