Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003534-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein (G protein), gamma 2
Gene Name: GNG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043004: 100%, ENSRNOG00000019570: 79%
Entrez Gene ID: 54331
Uniprot ID: P59768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREK
Gene Sequence ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREK
Gene ID - Mouse ENSMUSG00000043004
Gene ID - Rat ENSRNOG00000019570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation)
Datasheet Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation)
Datasheet Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation)
Citations for Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) – 2 Found
Pirone, Andrea; Cozzi, Bruno; Edelstein, Larry; Peruffo, Antonella; Lenzi, Carla; Quilici, Francesca; Antonini, Rita; Castagna, Maura. Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum. Plos One. 7(9):e44745.  PubMed
Cozzi, Bruno; Roncon, Giulia; Granato, Alberto; Giurisato, Maristella; Castagna, Maura; Peruffo, Antonella; Panin, Mattia; Ballarin, Cristina; Montelli, Stefano; Pirone, Andrea. The claustrum of the bottlenose dolphin Tursiops truncatus (Montagu 1821). Frontiers In Systems Neuroscience. 8( 24734007):42.  PubMed