Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003534-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GNG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043004: 100%, ENSRNOG00000019570: 79%
Entrez Gene ID: 54331
Uniprot ID: P59768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREK |
| Gene Sequence | ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREK |
| Gene ID - Mouse | ENSMUSG00000043004 |
| Gene ID - Rat | ENSRNOG00000019570 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) | |
| Datasheet | Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) | |
| Datasheet | Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) |
| Citations for Anti GNG2 pAb (ATL-HPA003534 w/enhanced validation) – 2 Found |
| Pirone, Andrea; Cozzi, Bruno; Edelstein, Larry; Peruffo, Antonella; Lenzi, Carla; Quilici, Francesca; Antonini, Rita; Castagna, Maura. Topography of Gng2- and NetrinG2-expression suggests an insular origin of the human claustrum. Plos One. 7(9):e44745. PubMed |
| Cozzi, Bruno; Roncon, Giulia; Granato, Alberto; Giurisato, Maristella; Castagna, Maura; Peruffo, Antonella; Panin, Mattia; Ballarin, Cristina; Montelli, Stefano; Pirone, Andrea. The claustrum of the bottlenose dolphin Tursiops truncatus (Montagu 1821). Frontiers In Systems Neuroscience. 8( 24734007):42. PubMed |