Anti GMPR2 pAb (ATL-HPA067884)

Atlas Antibodies

Catalog No.:
ATL-HPA067884-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: guanosine monophosphate reductase 2
Gene Name: GMPR2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002326: 44%, ENSRNOG00000020216: 44%
Entrez Gene ID: 51292
Uniprot ID: Q9P2T1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTSCLPALRFIATPRLSAMPHIDNDVKLDFKD
Gene Sequence MTSCLPALRFIATPRLSAMPHIDNDVKLDFKD
Gene ID - Mouse ENSMUSG00000002326
Gene ID - Rat ENSRNOG00000020216
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GMPR2 pAb (ATL-HPA067884)
Datasheet Anti GMPR2 pAb (ATL-HPA067884) Datasheet (External Link)
Vendor Page Anti GMPR2 pAb (ATL-HPA067884) at Atlas Antibodies

Documents & Links for Anti GMPR2 pAb (ATL-HPA067884)
Datasheet Anti GMPR2 pAb (ATL-HPA067884) Datasheet (External Link)
Vendor Page Anti GMPR2 pAb (ATL-HPA067884)