Anti GMPPA pAb (ATL-HPA035513)

Atlas Antibodies

SKU:
ATL-HPA035513-25
  • Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GDP-mannose pyrophosphorylase A
Gene Name: GMPPA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033021: 99%, ENSRNOG00000019946: 99%
Entrez Gene ID: 29926
Uniprot ID: Q96IJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL
Gene Sequence TCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL
Gene ID - Mouse ENSMUSG00000033021
Gene ID - Rat ENSRNOG00000019946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GMPPA pAb (ATL-HPA035513)
Datasheet Anti GMPPA pAb (ATL-HPA035513) Datasheet (External Link)
Vendor Page Anti GMPPA pAb (ATL-HPA035513) at Atlas Antibodies

Documents & Links for Anti GMPPA pAb (ATL-HPA035513)
Datasheet Anti GMPPA pAb (ATL-HPA035513) Datasheet (External Link)
Vendor Page Anti GMPPA pAb (ATL-HPA035513)