Anti GMNN pAb (ATL-HPA054597)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054597-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GMNN
Alternative Gene Name: Gem
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006715: 65%, ENSRNOG00000018782: 65%
Entrez Gene ID: 51053
Uniprot ID: O75496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK |
| Gene Sequence | GRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK |
| Gene ID - Mouse | ENSMUSG00000006715 |
| Gene ID - Rat | ENSRNOG00000018782 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GMNN pAb (ATL-HPA054597) | |
| Datasheet | Anti GMNN pAb (ATL-HPA054597) Datasheet (External Link) |
| Vendor Page | Anti GMNN pAb (ATL-HPA054597) at Atlas Antibodies |
| Documents & Links for Anti GMNN pAb (ATL-HPA054597) | |
| Datasheet | Anti GMNN pAb (ATL-HPA054597) Datasheet (External Link) |
| Vendor Page | Anti GMNN pAb (ATL-HPA054597) |