Anti GMNN pAb (ATL-HPA054597)

Atlas Antibodies

Catalog No.:
ATL-HPA054597-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: geminin, DNA replication inhibitor
Gene Name: GMNN
Alternative Gene Name: Gem
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006715: 65%, ENSRNOG00000018782: 65%
Entrez Gene ID: 51053
Uniprot ID: O75496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK
Gene Sequence GRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK
Gene ID - Mouse ENSMUSG00000006715
Gene ID - Rat ENSRNOG00000018782
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GMNN pAb (ATL-HPA054597)
Datasheet Anti GMNN pAb (ATL-HPA054597) Datasheet (External Link)
Vendor Page Anti GMNN pAb (ATL-HPA054597) at Atlas Antibodies

Documents & Links for Anti GMNN pAb (ATL-HPA054597)
Datasheet Anti GMNN pAb (ATL-HPA054597) Datasheet (External Link)
Vendor Page Anti GMNN pAb (ATL-HPA054597)