Anti GMNN pAb (ATL-HPA049977 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049977-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GMNN
Alternative Gene Name: Gem
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006715: 90%, ENSRNOG00000018782: 88%
Entrez Gene ID: 51053
Uniprot ID: O75496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDN |
| Gene Sequence | RRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDN |
| Gene ID - Mouse | ENSMUSG00000006715 |
| Gene ID - Rat | ENSRNOG00000018782 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) | |
| Datasheet | Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) | |
| Datasheet | Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) |
| Citations for Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) – 4 Found |
| Cappell, Steven D; Chung, Mingyu; Jaimovich, Ariel; Spencer, Sabrina L; Meyer, Tobias. Irreversible APC(Cdh1) Inactivation Underlies the Point of No Return for Cell-Cycle Entry. Cell. 2016;166(1):167-80. PubMed |
| Cappell, Steven D; Mark, Kevin G; Garbett, Damien; Pack, Lindsey R; Rape, Michael; Meyer, Tobias. EMI1 switches from being a substrate to an inhibitor of APC/C(CDH1) to start the cell cycle. Nature. 2018;558(7709):313-317. PubMed |
| Liu, Chad; Konagaya, Yumi; Chung, Mingyu; Daigh, Leighton H; Fan, Yilin; Yang, Hee Won; Terai, Kenta; Matsuda, Michiyuki; Meyer, Tobias. Altered G1 signaling order and commitment point in cells proliferating without CDK4/6 activity. Nature Communications. 2020;11(1):5305. PubMed |
| Suski, Jan M; Ratnayeke, Nalin; Braun, Marcin; Zhang, Tian; Strmiska, Vladislav; Michowski, Wojciech; Can, Geylani; Simoneau, Antoine; Snioch, Konrad; Cup, Mikolaj; Sullivan, Caitlin M; Wu, Xiaoji; Nowacka, Joanna; Branigan, Timothy B; Pack, Lindsey R; DeCaprio, James A; Geng, Yan; Zou, Lee; Gygi, Steven P; Walter, Johannes C; Meyer, Tobias; Sicinski, Piotr. CDC7-independent G1/S transition revealed by targeted protein degradation. Nature. 2022;605(7909):357-365. PubMed |