Anti GMNN pAb (ATL-HPA049977 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049977-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: geminin, DNA replication inhibitor
Gene Name: GMNN
Alternative Gene Name: Gem
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006715: 90%, ENSRNOG00000018782: 88%
Entrez Gene ID: 51053
Uniprot ID: O75496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDN
Gene Sequence RRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDN
Gene ID - Mouse ENSMUSG00000006715
Gene ID - Rat ENSRNOG00000018782
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GMNN pAb (ATL-HPA049977 w/enhanced validation)
Datasheet Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GMNN pAb (ATL-HPA049977 w/enhanced validation)
Datasheet Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GMNN pAb (ATL-HPA049977 w/enhanced validation)
Citations for Anti GMNN pAb (ATL-HPA049977 w/enhanced validation) – 4 Found
Cappell, Steven D; Chung, Mingyu; Jaimovich, Ariel; Spencer, Sabrina L; Meyer, Tobias. Irreversible APC(Cdh1) Inactivation Underlies the Point of No Return for Cell-Cycle Entry. Cell. 2016;166(1):167-80.  PubMed
Cappell, Steven D; Mark, Kevin G; Garbett, Damien; Pack, Lindsey R; Rape, Michael; Meyer, Tobias. EMI1 switches from being a substrate to an inhibitor of APC/C(CDH1) to start the cell cycle. Nature. 2018;558(7709):313-317.  PubMed
Liu, Chad; Konagaya, Yumi; Chung, Mingyu; Daigh, Leighton H; Fan, Yilin; Yang, Hee Won; Terai, Kenta; Matsuda, Michiyuki; Meyer, Tobias. Altered G1 signaling order and commitment point in cells proliferating without CDK4/6 activity. Nature Communications. 2020;11(1):5305.  PubMed
Suski, Jan M; Ratnayeke, Nalin; Braun, Marcin; Zhang, Tian; Strmiska, Vladislav; Michowski, Wojciech; Can, Geylani; Simoneau, Antoine; Snioch, Konrad; Cup, Mikolaj; Sullivan, Caitlin M; Wu, Xiaoji; Nowacka, Joanna; Branigan, Timothy B; Pack, Lindsey R; DeCaprio, James A; Geng, Yan; Zou, Lee; Gygi, Steven P; Walter, Johannes C; Meyer, Tobias; Sicinski, Piotr. CDC7-independent G1/S transition revealed by targeted protein degradation. Nature. 2022;605(7909):357-365.  PubMed