Anti GMEB2 pAb (ATL-HPA067455)

Atlas Antibodies

Catalog No.: ATL-HPA067455-25

Protein Description: glucocorticoid modulatory element binding protein 2
Gene Name: GMEB2
Alternative Gene Name: KIAA1269, P79PIF, PIF79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038705: 96%, ENSRNOG00000013339: 98%
Entrez Gene ID: 26205
Uniprot ID: Q9UKD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPRLARATSGPAAMASQVLTQSAQ
• Gene Sequence: ASHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPRLARATSGPAAMASQVLTQSAQ
• Gene ID - Mouse: ENSMUSG00000038705
• Gene ID - Rat: ENSRNOG00000013339
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.