Anti GMEB2 pAb (ATL-HPA067455)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067455-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GMEB2
Alternative Gene Name: KIAA1269, P79PIF, PIF79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038705: 96%, ENSRNOG00000013339: 98%
Entrez Gene ID: 26205
Uniprot ID: Q9UKD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPRLARATSGPAAMASQVLTQSAQ |
| Gene Sequence | ASHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPVKRPRLARATSGPAAMASQVLTQSAQ |
| Gene ID - Mouse | ENSMUSG00000038705 |
| Gene ID - Rat | ENSRNOG00000013339 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GMEB2 pAb (ATL-HPA067455) | |
| Datasheet | Anti GMEB2 pAb (ATL-HPA067455) Datasheet (External Link) |
| Vendor Page | Anti GMEB2 pAb (ATL-HPA067455) at Atlas Antibodies |
| Documents & Links for Anti GMEB2 pAb (ATL-HPA067455) | |
| Datasheet | Anti GMEB2 pAb (ATL-HPA067455) Datasheet (External Link) |
| Vendor Page | Anti GMEB2 pAb (ATL-HPA067455) |